OTOR Human-Other

our services
our products
Quotations & Ordering:

For quotations, please use our online quotation form, and you may also contact us by

service@kendallscientific.com

Phone:

+1-888.733.6849 (Toll-free)
+1-617.299.7367 (Int’l))

Fax:

+1-888.733.6849

Our customer service representatives are available 24 hours, Monday through Friday to assist you.

OTOR Human

Qty


Total
$65
Catalog #
CYPS-589
Size
Description
Otoraplin Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 111 amino acids and having a molecular mass of 12.7 kDa.The OTOR is purified by proprietary chromatographic techniques.
Additional Information
Introduction OTOR proteins is also known as fibrocyte-derived protein (Fdp) and Melanoma inhibitory activity-like (MIAL). Otoraplin is a member of the melanoma-inhibiting activity gene family. Otoraplin is a secreted 16 kDa globular protein that is expressed in the inner ear by periotic mesenchyme and developing and mature fibrocytes. OTOR is highly homologous to MIA/cartilage-derived retinoic acid-sensitive protein (CD-RAP), which is a cartilage-specific protein that is also expressed in malignant melanoma cells. The 111 amino acid mature human otoraplin contains 1 SH3 domain (46 – 107 amino acids) and a Tyr at position 50 that is reportedly sulfated. Otoraplin takes pasrt in the initiation of periotic mesenchyme chondrogenesis. Otoraplin is secreted throµgh the Golgi apparatus and plays a role in cartilage development and maintenance. A frequent polymorphism in the translation start codon of OTOR can abolish translation and may be associated with forms of deafness.
Synonyms Otoraplin, Fibrocyte-derived protein, Melanoma inhibitory activity-like protein, OTOR, MIAL, FDP, MIAL1, MGC126737, MGC126739.
Source Escherichia Coli.
Physical Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation The OTOR protein was lyophilized from a concentrated (1mg/ml) solution containing 20mM PBS pH-7.4 and 130mM NaCl.
Solubility It is recommended to reconstitute the lyophilized Otoraplin in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Stability Lyophilized OTOR Recombinant althoµgh stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution OTOR should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Amino Acid Sequence VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE.
Purity Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Usage NeoBiolab's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals.
Background

N/A

Protocol

N/A

MSDS
Reviews
Kendall Scientific welcomes feedback from its customers.

If you have used an our product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information.

If you have any additional inquiries please email technical services at info@kendallscientific.com.

Thank you for your support.

promotions


Custom Monoclonal Antibody
MassAb Technologies
Image
Free Trial Custom Polyclonal Antibody
You will receive free purified antibodies for validation
Image
Custom Peptides Synthesis

Start from $40/each

new technologies

Image
Optimized for enhanced
expression levels
XPromoter 2.0
Image
E.coli/insect cells/293 & CHO

3 in 1 expression system
Image
MassAb Technologies

Cover All Epitopes