PLA2G2D Human-Secreted Phospholipase A2

our services
our products
Quotations & Ordering:

For quotations, please use our online quotation form, and you may also contact us by

service@kendallscientific.com

Phone:

+1-888.733.6849 (Toll-free)
+1-617.299.7367 (Int’l))

Fax:

+1-888.733.6849

Our customer service representatives are available 24 hours, Monday through Friday to assist you.

PLA2G2D Human

Qty


Total
$65
Catalog #
ENPS-333
Size
Description
Secreted Phospholipase A2-IID Human Recombinant was produced with N-terminal His-Tag. PLA2G2D His-Tagged Fusion protein is 16.4 kDa containing 125 amino acid residues of the human secreted phospholipase A2-IID and 16 additional amino acid residues – His-Tag (underlined).MRGSHHHHHHGMASHMGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCGIYKYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC.
Additional Information
Introduction Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators.The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of low molecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense.This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso- PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci.In mice, sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. Instillation of bacteria into the bronchi was associated with surfactant degradation and a decrease in large: small ratio of surfactant aggregates in rats.
Synonyms Group IID secretory phospholipase A2, EC 3.1.1.4, Phosphatidylcholine 2-acylhydrolase GIID, GIID sPLA2, PLA2IID, sPLA(2)-IID, Secretory-type PLA, stroma-associated homolog, SPLASH, sPLA2S, PLA2G2D.
Source Escherichia Coli.
Physical Appearance Sterile Filtered lyophilized (freeze-dried) powder.
Formulation Sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH-4.
Solubility Add 0.2 ml of 0.1M Acetate buffer pH-4 and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 μg/ml. In higher concentrations the solubility of this antigen is limited.
Stability Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
Purity Purity of recombinant the human secreted phospholipase A2-IIA is >95%.
Usage NeoBiolab's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals.
Purification Method Ni-NTA affinity chromatography.
Specificity The amino acid sequence of the recombinant human Secreted Phospholipase A2-IID is 100% homologous to the amino acid sequence of the human Secreted Phospholipase A2-IID without signal sequence.
Background

N/A

Protocol

N/A

MSDS
Reviews
Kendall Scientific welcomes feedback from its customers.

If you have used an our product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information.

If you have any additional inquiries please email technical services at info@kendallscientific.com.

Thank you for your support.

promotions


Custom Monoclonal Antibody
MassAb Technologies
Image
Free Trial Custom Polyclonal Antibody
You will receive free purified antibodies for validation
Image
Custom Peptides Synthesis

Start from $40/each

new technologies

Image
Optimized for enhanced
expression levels
XPromoter 2.0
Image
E.coli/insect cells/293 & CHO

3 in 1 expression system
Image
MassAb Technologies

Cover All Epitopes